PDB entry 1rob

View 1rob on RCSB PDB site
Description: structure of the crystalline complex of cytidylic acid (2'-cmp) with ribonuclease at 1.6 angstroms resolution
Deposited on 1993-08-23, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.17
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1rob__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rob_ (-)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv