PDB entry 1ro9

View 1ro9 on RCSB PDB site
Description: crystal structures of the catalytic domain of phosphodiesterase 4b2b complexed with 8-br-amp
Deposited on 2003-12-01, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.21
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ro9a_
  • Chain 'B':
    Domains in SCOP 1.71: d1ro9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ro9A (A:)
    msisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfr
    issdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifa
    aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkq
    rqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhc
    adlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyi
    vhplwetwadlvqpdaqdildtlednrnwyqsmipqapappldeqnrdcqglmekfqfel
    tldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ro9A (A:)
    sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
    ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
    aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
    qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
    dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
    hplwetwadlvqpdaqdildtlednrnwyqsmipqapa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ro9B (B:)
    msisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfr
    issdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifa
    aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkq
    rqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhc
    adlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyi
    vhplwetwadlvqpdaqdildtlednrnwyqsmipqapappldeqnrdcqglmekfqfel
    tldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ro9B (B:)
    sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
    ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
    aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
    qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
    dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
    hplwetwadlvqpdaqdildtlednrnwyqsmipqap