PDB entry 1ro6

View 1ro6 on RCSB PDB site
Description: crystal structure of pde4b2b complexed with rolipram (r & s)
Deposited on 2003-12-01, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ro6a_
  • Chain 'B':
    Domains in SCOP 1.71: d1ro6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ro6A (A:)
    msisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfr
    issdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifa
    aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkq
    rqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhc
    adlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyi
    vhplwetwadlvqpdaqdildtlednrnwyqsmipqapappldeqnrdcqglmekfqfel
    tldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ro6A (A:)
    sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
    ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
    aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
    qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
    dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
    hplwetwadlvqpdaqdildtlednrnwyqsmipqapappldeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ro6B (B:)
    msisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfr
    issdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifa
    aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkq
    rqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhc
    adlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyi
    vhplwetwadlvqpdaqdildtlednrnwyqsmipqapappldeqnrdcqglmekfqfel
    tldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ro6B (B:)
    sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
    ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
    aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
    qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
    dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
    hplwetwadlvqpdaqdildtlednrnwyqsmipqapappldeq