PDB entry 1rnu

View 1rnu on RCSB PDB site
Description: refinement of the crystal structure of ribonuclease s. comparison with and between the various ribonuclease a structures
Class: hydrolase(phosphoric diester,RNA)
Keywords: hydrolase(phosphoric diester,RNA)
Deposited on 1992-02-19, released 1994-01-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease s
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rnua_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1rnuA (A:)
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

    Sequence, based on observed residues (ATOM records): (download) 
    >1rnuA (A:)
ketaaakferqhmdsnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackng
qtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv