PDB entry 1rnu

View 1rnu on RCSB PDB site
Description: refinement of the crystal structure of ribonuclease s. comparison with and between the various ribonuclease a structures
Class: hydrolase(phosphoric diester,RNA)
Keywords: hydrolase(phosphoric diester, RNA)
Deposited on 1992-02-19, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease s
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rnua_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rnuA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rnuA (A:)
    ketaaakferqhmdsnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackng
    qtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv