PDB entry 1rnm

View 1rnm on RCSB PDB site
Description: ribonuclease a complex with cytidylic acid (5'cmp) crystallized from 80% ammonium sulphate
Deposited on 1995-11-08, released 1996-04-03
The last revision prior to the SCOP 1.59 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.158
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'E':
  Domains in SCOP 1.59: d1rnme_

PDB Chain Sequences:

• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rnmE (E:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv