PDB entry 1rnf

View 1rnf on RCSB PDB site
Description: x-ray crystal structure of unliganded human ribonuclease 4
Deposited on 1998-10-29, released 1999-10-29
The last revision prior to the SCOP 1.55 freeze date was dated 1999-10-29, with a file datestamp of 1999-10-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.174
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1rnfa_
  • Chain 'B':
    Domains in SCOP 1.55: d1rnfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rnfA (A:)
    mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
    tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rnfB (B:)
    mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
    tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg