PDB entry 1rnf

View 1rnf on RCSB PDB site
Description: x-ray crystal structure of unliganded human ribonuclease 4
Class: hydrolase
Keywords: hydrolase, ribonuclease, phosphodiesterase
Deposited on 1998-10-29, released 1999-10-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.174
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribonuclease 4)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34096 (0-119)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d1rnfa1, d1rnfa2
  • Chain 'B':
    Compound: protein (ribonuclease 4)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34096 (0-119)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d1rnfb1, d1rnfb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rnfA (A:)
    mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
    tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rnfB (B:)
    mqdgmyqrflrqhvhpeetggsdrycnlmmqrrkmtlyhckrfntfihediwnirsicst
    tniqckngkmnchegvvkvtdcrdtgssrapncryraiastrrvviacegnpqvpvhfdg