PDB entry 1rnb

View 1rnb on RCSB PDB site
Description: crystal structure of a barnase-d(*gp*c) complex at 1.9 angstroms resolution
Deposited on 1991-03-19, released 1992-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1rnba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rnbA (A:)
    qvintfdgvadylqtyhklpndyitkseaqalgwvaskgnladvapgksiggdifsnreg
    klpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir