PDB entry 1rnb

View 1rnb on RCSB PDB site
Description: crystal structure of a barnase-d(*gp*c) complex at 1.9 angstroms resolution
Class: endonuclease
Keywords: endonuclease
Deposited on 1991-03-19, released 1992-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: barnase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • conflict (21-22)
    Domains in SCOPe 2.07: d1rnba_
  • Chain 'C':
    Compound: DNA (5'-d(*gp*c)-3')
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rnbA (A:)
    aqvintfdgvadylqtyhklpndyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rnbA (A:)
    qvintfdgvadylqtyhklpndyitkseaqalgwvaskgnladvapgksiggdifsnreg
    klpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'C':
    No sequence available.