PDB entry 1rn8

View 1rn8 on RCSB PDB site
Description: Crystal structure of dUTPase complexed with substrate analogue imido-dUTP
Class: hydrolase
Keywords: Jelly Roll, Enzyme-ligand complex, HYDROLASE
Deposited on 2003-12-01, released 2004-09-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.139
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Escherichia coli [TaxId:562]
    Gene: DUT, DNAS, SOF, B3640
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06968 (1-151)
      • initiating met (0)
    Domains in SCOPe 2.01: d1rn8a_
  • Heterogens: MG, ACT, DUP, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1rn8A (A:)
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfdatdrgeggfghsgrq

    Sequence, based on observed residues (ATOM records): (download) 
    >1rn8A (A:)
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfdfrq