PDB entry 1rmz

View 1rmz on RCSB PDB site
Description: Crystal structure of the catalytic domain of human MMP12 complexed with the inhibitor NNGH at 1.3 A resolution
Class: hydrolase
Keywords: matrix metalloproteinase, mmp12, elastase, complex (elastase/inhibitor), metallo elastase, nngh
Deposited on 2003-11-28, released 2004-12-14
The last revision prior to the SCOP 1.73 freeze date was dated 2007-06-12, with a file datestamp of 2007-06-08.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.181
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: HOMO SAPIENS
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • cloning artifact (0)
      • engineered (66)
    Domains in SCOP 1.73: d1rmza_
  • Heterogens: ZN, CA, NGH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rmzA (A:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslyg