PDB entry 1rmr

View 1rmr on RCSB PDB site
Description: Crystal Structure of Schistatin, a Disintegrin Homodimer from saw-scaled Viper (Echis carinatus) at 2.5 A resolution
Class: protein binding
Keywords: disintegrin, homodimer, echis carinatus, PROTEIN BINDING
Deposited on 2003-11-28, released 2004-06-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disintegrin schistatin
    Species: Echis carinatus [TaxId:40353]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rmra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rmrA (A:)
    nsvhpccdpvicepregehcisgpccencyflnsgtickrargdgnqdyctgitpdcprn
    rynv