PDB entry 1rmq

View 1rmq on RCSB PDB site
Description: Crystal structure of AphA class B acid phosphatase/phosphotransferase with osmiate mimicking the catalytic intermediate
Class: hydrolase
Keywords: Class B acid phosphatase, DDDD acid phosphatase, metallo-enzyme, osmiate, HYDROLASE
Deposited on 2003-11-28, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class B acid phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: APHA, NAPA, B4055, SF4149, S3580
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rmqa_
  • Chain 'B':
    Compound: Class B acid phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: APHA, NAPA, B4055, SF4149, S3580
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rmqb_
  • Heterogens: CO, OS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rmqA (A:)
    sspsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgk
    ktfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptkte
    tvsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvga
    rgirilrasnstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rmqA (A:)
    splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
    spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
    ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
    rilrasnstykplpqagafgeevivnsey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rmqB (B:)
    sspsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgk
    ktfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptkte
    tvsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvga
    rgirilrasnstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rmqB (B:)
    plnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktfs
    pesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvsk
    tladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargir
    ilrasnstykplpqagafgeevivnsey