PDB entry 1rmo

View 1rmo on RCSB PDB site
Description: Probing the Role of Tryptophans in Aequorea Victoria Green Fluorescent Proteins with an Expanded Genetic Code
Class: luminescent protein
Keywords: Beta-barrel; GFP; Noncanonical amino acid, LUMINESCENT PROTEIN
Deposited on 2003-11-28, released 2004-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: wunen-nonfunctional GFP fusion protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • modified residue (56)
      • chromophore (65)
    Domains in SCOPe 2.06: d1rmoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rmoA (A:)
    vskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpxptl
    vttlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagitlgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rmoA (A:)
    geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpxptlvtt
    lgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
    elkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyq
    qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi