PDB entry 1rmm

View 1rmm on RCSB PDB site
Description: Probing the Role of Tryptophans in Aequorea Victoria Green Fluorescent Proteins with an Expanded Genetic Code
Class: luminescent protein
Keywords: Beta-barrel; GFP; Noncanonical amino acid, LUMINESCENT PROTEIN
Deposited on 2003-11-28, released 2004-06-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-05-19, with a file datestamp of 2009-05-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: SIGF1-GFP fusion protein
  Species: Aequorea victoria [TaxId:6100]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42212 (0-225)
    • chromophore (64)
  Domains in SCOPe 2.05: d1rmma_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rmmA (A:)
  skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpxptlv
  ttlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
  rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
  yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi