PDB entry 1rml

View 1rml on RCSB PDB site
Description: nmr study of acid fibroblast growth factor bound to 1,3,6-naphthalene trisulphonate, 26 structures
Class: growth factor
Keywords: growth factor, fibroblast growth factor, antitumoral, naphthalene
Deposited on 1998-05-21, released 1998-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acidic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rmla_
  • Heterogens: NTS

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rmlA (A:)
    maegeittftaltekfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlq
    lsaesvgevyikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaek
    nwfvglkkngsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rmlA (A:)
    kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
    dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
    ilflplpvssd