PDB entry 1rmk

View 1rmk on RCSB PDB site
Description: Solution structure of conotoxin MrVIB
Class: toxin
Keywords: beta sheet, cystine knot, TOXIN
Deposited on 2003-11-28, released 2004-09-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Mu-O-conotoxin MrVIB
  Species: Conus marmoreus [TaxId:42752]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q26443 (0-30)
  Domains in SCOPe 2.06: d1rmka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rmkA (A:)
  acskkweycivpilgfvyccpglicgpfvcv