PDB entry 1rmk

View 1rmk on RCSB PDB site
Description: Solution structure of conotoxin MrVIB
Class: toxin
Keywords: beta sheet, cystine knot, TOXIN
Deposited on 2003-11-28, released 2004-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mu-O-conotoxin MrVIB
    Species: Conus marmoreus [TaxId:42752]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rmka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rmkA (A:)
    acskkweycivpilgfvyccpglicgpfvcv