PDB entry 1rmj

View 1rmj on RCSB PDB site
Description: c-terminal domain of insulin-like growth factor (igf) binding protein- 6: structure and interaction with igf-ii
Deposited on 2003-11-28, released 2004-09-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rmja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rmjA (A:)
    syyhhhhhhdydipttenlyfqgamgsgpcrrhldsvlqqlqtevyrgaqtlyvpncdhr
    gfyrkrqcrssqgqrrgpcwcvdrmgkslpgspdgngssscptgssg