PDB entry 1rmj

View 1rmj on RCSB PDB site
Description: C-terminal domain of insulin-like growth factor (IGF) binding protein-6: structure and interaction with IGF-II
Class: hormone/growth factor
Keywords: Insulin-like growth factor binding protein, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2003-11-28, released 2004-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin-like growth factor binding protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: IGFBP6, IBP6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24592 (27-106)
      • cloning artifact (0-26)
    Domains in SCOPe 2.08: d1rmja1, d1rmja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rmjA (A:)
    syyhhhhhhdydipttenlyfqgamgsgpcrrhldsvlqqlqtevyrgaqtlyvpncdhr
    gfyrkrqcrssqgqrrgpcwcvdrmgkslpgspdgngssscptgssg