PDB entry 1rmi

View 1rmi on RCSB PDB site
Description: refined crystal structure of recombinant murine interferon-b at 2.15 angstroms resolution and its relationship to those of the other type i interferons
Deposited on 1994-12-12, released 1995-02-14
The last revision prior to the SCOP 1.57 freeze date was dated 1995-02-14, with a file datestamp of 1995-02-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.191
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1rmi__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rmi_ (-)
  inykqlqlqertnirkcqelleqlngkinltyradfkipmemtekmqksytafaiqemlq
  nvflvfrnnfsstgwnetivvrlldelhqqtvflktvleekqeerltwemsstalhlksy
  ywrvqrylklmkynsyawmvvraeifrnfliirrltrnfq