PDB entry 1rmi

View 1rmi on RCSB PDB site
Description: refined crystal structure of recombinant murine interferon-b at 2.15 angstroms resolution and its relationship to those of the other type I interferons
Class: cytokine
Keywords: cytokine
Deposited on 1994-12-12, released 1995-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 1995-02-14, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.191
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: interferon-beta
  Species: Mus musculus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01575 (0-159)
  Domains in SCOPe 2.08: d1rmia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rmiA (A:)
  inykqlqlqertnirkcqelleqlngkinltyradfkipmemtekmqksytafaiqemlq
  nvflvfrnnfsstgwnetivvrlldelhqqtvflktvleekqeerltwemsstalhlksy
  ywrvqrylklmkynsyawmvvraeifrnfliirrltrnfq