PDB entry 1rmf

View 1rmf on RCSB PDB site
Description: structures of a monoclonal anti-icam-1 antibody r6.5 fragment at 2.8 angstroms resolution
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1994-12-16, released 1995-02-27
The last revision prior to the SCOP 1.75 freeze date was dated 1995-02-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.188
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2a-kappa r6.5 fab (heavy chain)
    Database cross-references and differences (RAF-indexed):
    • GB AAC02212 (1-212)
      • conflict (5)
      • conflict (29)
      • conflict (32-33)
      • conflict (38)
      • conflict (52)
      • conflict (54)
      • conflict (56)
      • conflict (61-62)
      • conflict (76)
      • conflict (80)
      • insertion (98-100)
      • conflict (102)
      • conflict (104)
      • conflict (106)
      • conflict (113-114)
      • conflict (118)
      • conflict (127)
      • conflict (145)
    Domains in SCOP 1.75: d1rmfh1, d1rmfh2
  • Chain 'L':
    Compound: igg2a-kappa r6.5 fab (light chain)
    Database cross-references and differences (RAF-indexed):
    • PIR S16112 (0-218)
      • conflict (6)
      • conflict (35)
      • conflict (38)
      • conflict (44)
      • conflict (47)
      • conflict (50)
      • conflict (54)
      • conflict (93)
      • conflict (95)
      • conflict (100)
      • conflict (107)
    Domains in SCOP 1.75: d1rmfl1, d1rmfl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rmfH (H:)
    qvqlqqsgpelvrpgvsvkisckgsgytfidyaihwvkeshakslewigvisaysgdtny
    nqkfkgkatmtvdkssntaylelarltsedsaiyycarggwlllsfdywgqgttltvssa
    kttapsvtplapvcgdttgssvtlgvlvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkki
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rmfL (L:)
    dvvmtqsplslpvslgdqasiscrssqslvhsngnnylhwylqksgqapklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpltfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec