PDB entry 1rm8

View 1rm8 on RCSB PDB site
Description: Crystal structure of the catalytic domain of MMP-16/MT3-MMP: Characterization of MT-MMP specific features
Class: hydrolase
Keywords: MMP-16, MT3-MMP, MT-MMP, Membrane Type - Matrix Metalloproteinase, Batimastat, Hydroxamate inhibitor, Protease, HYDROLASE
Deposited on 2003-11-27, released 2004-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-28, with a file datestamp of 2021-07-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix metalloproteinase-16
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rm8a_
  • Heterogens: ZN, CA, BAT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rm8A (A:)
    gqkwqhkhitysiknvtpkvgdpetrkairrafdvwqnvtpltfeevpyselengkrdvd
    itiifasgfhgdsspfdgeggflahayfpgpgiggdthfdsdepwtlgnpnhdgndlflv
    avhelghalglehsndptaimapfyqymetdnfklpnddlqgiqkiygp