PDB entry 1rm7

View 1rm7 on RCSB PDB site
Description: Crystal structure of AphA class B acid phosphatase/phosphotransferase ternary complex with adenosine and phosphate at 2 A resolution
Class: hydrolase
Keywords: Class B acid phosphatase, DDDD acid phosphatase, metallo-enzyme, AMP
Deposited on 2003-11-27, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-11-29, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.168
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class B acid phosphatase
    Species: Escherichia coli
    Gene: APHA, NAPA, B4055, SF4149, S3580
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rm7a_
  • Chain 'C':
    Compound: Class B acid phosphatase
    Species: Escherichia coli
    Gene: APHA, NAPA, B4055, SF4149, S3580
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rm7c_
  • Heterogens: MG, SPM, PO4, AU3, ADN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rm7A (A:)
    sspsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgk
    ktfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptkte
    tvsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvga
    rgirilrasnstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rm7A (A:)
    spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
    tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
    vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
    girilrasnstykplpqagafgeevivnsey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rm7C (C:)
    sspsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgk
    ktfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptkte
    tvsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvga
    rgirilrasnstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rm7C (C:)
    spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
    tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
    vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
    girilrasnstykplpqagafgeevivnsey