PDB entry 1rm3

View 1rm3 on RCSB PDB site
Description: Crystal structure of mutant T33A of photosynthetic glyceraldehyde-3-phosphate dehydrogenase A4 isoform, complexed with NADP
Class: oxidoreductase
Keywords: Rossmann fold, GAPDH-NADP complex, OXIDOREDUCTASE
Deposited on 2003-11-27, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glyceraldehyde 3-phosphate dehydrogenase A
    Species: Spinacia oleracea [TaxId:3562]
    Gene: GAPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19866 (0-End)
      • engineered (35)
    Domains in SCOPe 2.07: d1rm3a1, d1rm3a2
  • Chain 'B':
    Compound: Glyceraldehyde 3-phosphate dehydrogenase A
    Species: Spinacia oleracea [TaxId:3562]
    Gene: GAPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19866 (0-336)
      • engineered (35)
    Domains in SCOPe 2.07: d1rm3b1, d1rm3b2
  • Chain 'O':
    Compound: Glyceraldehyde 3-phosphate dehydrogenase A
    Species: Spinacia oleracea [TaxId:3562]
    Gene: GAPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19866 (0-336)
      • engineered (35)
    Domains in SCOPe 2.07: d1rm3o1, d1rm3o2
  • Heterogens: SO4, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rm3A (A:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindaggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rm3A (A:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindaggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rm3B (B:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindaggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqa
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rm3O (O:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindaggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqa