PDB entry 1rm1

View 1rm1 on RCSB PDB site
Description: Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex
Class: transcription/DNA
Keywords: Yeast TFIIA, TBP protein, ATA-box DNA, TRANSCRIPTION/DNA COMPLEX
Deposited on 2003-11-26, released 2005-07-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.186
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TATA-box binding protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SPT15, BTF1, YER148W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rm1a1, d1rm1a2
  • Chain 'B':
    Compound: Transcription initiation factor IIA small chain
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TOA2, YKL058W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rm1b1, d1rm1b2
  • Chain 'C':
    Compound: Transcription initiation factor IIA large chain
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TOA1, YOR194C
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 5'-d(*ap*tp*cp*gp*ap*tp*cp*gp*ap*tp*ap*tp*ap*ap*ap*ap*cp*g)-3'
    Species:
    Gene:
  • Chain 'E':
    Compound: 5'-d(p*cp*gp*tp*tp*tp*tp*ap*tp*ap*tp*cp*gp*ap*tp*cp*gp*ap*t)-3'
    Species:
    Gene:
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rm1A (A:)
    madeerlkefkeankivfdpntrqvwenqnrdgtkpattfqseedikraapesekdtsat
    sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rm1A (A:)
    sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rm1B (B:)
    mavpgyyelyrrstignslvdaldtlisdgrieaslamrvletfdkvvaetlkdntqskl
    tvkgnldtygfcddvwtfivkncqvtvedshrdasqngsgdsqsvisvdklrivacnskk
    se
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rm1B (B:)
    pgyyelyrrstignslvdaldtlisdgrieaslamrvletfdkvvaetlkdntqskltvk
    gnldtygfcddvwtfivkncqvtvevisvdklrivacnskk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.