PDB entry 1rm0

View 1rm0 on RCSB PDB site
Description: Crystal Structure of Myo-Inositol 1-Phosphate Synthase From Saccharomyces cerevisiae In Complex With NAD+ and 2-deoxy-D-glucitol 6-(E)-vinylhomophosphonate
Class: isomerase
Keywords: Myo-Inositol 1-Phosphate Synthase, ISOMERASE
Deposited on 2003-11-26, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.189
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myo-inositol-phosphate synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: INO1
    Database cross-references and differences (RAF-indexed):
    • GB CAA60802 (Start-532)
    Domains in SCOPe 2.07: d1rm0a1, d1rm0a2
  • Chain 'B':
    Compound: myo-inositol-phosphate synthase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: INO1
    Database cross-references and differences (RAF-indexed):
    • GB CAA60802 (Start-532)
    Domains in SCOPe 2.07: d1rm0b1, d1rm0b2
  • Heterogens: MN, D6P, NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rm0A (A:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rm0A (A:)
    itsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgi
    mliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvya
    pfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyyp
    dfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtante
    ryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvql
    aehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrs
    keiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghn
    risihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypvltflsywl
    kapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rm0B (B:)
    mtedniapitsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldl
    kkpeklgimliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgid
    aegndvyapfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvk
    plpsiyypdfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvi
    vlwtanteryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqnt
    fvpglvqlaehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynl
    sapkqfrskeiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyys
    elmlgghnrisihnvcedsllatpliidllvmtefctrvsykkvdpvkedagkfenfypv
    ltflsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rm0B (B:)
    tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
    liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
    fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
    fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
    yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
    ehegtfiagddlksgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrsk
    eiskssviddiiasndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnr
    isihnvcedsllatpliidllvmtefctrvsykkvkfenfypvltflsywlkapltrpgf
    hpvnglnkqrtalenflrlliglpsqnelrfeerll