PDB entry 1rlw

View 1rlw on RCSB PDB site
Description: calcium-phospholipid binding domain from cytosolic phospholipase a2
Class: hydrolase
Keywords: hydrolase, c2 domain, calb domain
Deposited on 1997-10-28, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.227
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47712 (1-125)
      • engineered (123)
      • engineered (125)
    Domains in SCOPe 2.07: d1rlwa_
  • Heterogens: CD, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rlwA (A:)
    sshkftvvvlratkvtkgafgdmldtpdpyvelfisttpdsrkrtrhfnndinpvwnetf
    efildpnqenvleitlmdanyvmdetlgtatftvssmkvgekkevpfifnqvtemvlems
    levass