PDB entry 1rlv

View 1rlv on RCSB PDB site
Description: Crystal structure of a dimeric Archaeal Splicing Endonuclease
Class: hydrolase
Keywords: hydrolase
Deposited on 2003-11-26, released 2003-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.229
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative tRNA-intron endonuclease
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: ENDA, AF0900
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29362 (Start-304)
      • conflict (151)
    Domains in SCOPe 2.08: d1rlva1, d1rlva2, d1rlva3, d1rlva4
  • Chain 'B':
    Compound: Putative tRNA-intron endonuclease
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: ENDA, AF0900
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29362 (Start-304)
      • conflict (151)
    Domains in SCOPe 2.08: d1rlvb1, d1rlvb2, d1rlvb3, d1rlvb4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rlvA (A:)
    miggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrm
    edfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrla
    vvdeeseityfrvyepdmmgeqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvt
    lslieslylldlgklnllnadreelvkrarevernfdrryevyrnlkergfvvktgfkfg
    sefrvyrkvesvddlphseylvdiadsreirlidlaravrlaqnvrkrmvfaygknylcf
    ervkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rlvA (A:)
    iggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrme
    dfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrlav
    vdeeseityfrvyepdmmgeqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvtl
    slieslylldlgklnllnadreelvkrarevernfdrryevyrnlkergfvvktgfkfgs
    efrvyrkvesvddlphseylvdiadsreirlidlaravrlaqnvrkrmvfaygknylcfe
    rvkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rlvB (B:)
    miggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrm
    edfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrla
    vvdeeseityfrvyepdmmgeqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvt
    lslieslylldlgklnllnadreelvkrarevernfdrryevyrnlkergfvvktgfkfg
    sefrvyrkvesvddlphseylvdiadsreirlidlaravrlaqnvrkrmvfaygknylcf
    ervkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rlvB (B:)
    iggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrme
    dfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrlav
    vdeeseityfrvyepdmmgeqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvtl
    slieslylldlgklnllnadreelvkrarevernfdrryevyrnlkergfvvktgfkfgs
    efrvyrkvesvddlphseylvdiadsreirlidlaravrlaqnvrkrmvfaygknylcfe
    rvkv