PDB entry 1rlu

View 1rlu on RCSB PDB site
Description: Mycobacterium tuberculosis FtsZ in complex with GTP-gamma-S
Class: cell cycle, signaling protein
Keywords: cell cycle, tubulin, gtpase, signaling protein
Deposited on 2003-11-26, released 2004-08-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.182
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: FTSZ, RV2150C, MT2209, MTCY270.18, MB2174C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rlua1, d1rlua2
  • Chain 'B':
    Compound: cell division protein ftsz
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: FTSZ, RV2150C, MT2209, MTCY270.18, MB2174C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rlub1, d1rlub2
  • Heterogens: GSP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rluA (A:)
    gshmtpphnylavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkld
    vgrdstrglgagadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasi
    arklgaltvgvvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslm
    dafrsadevllngvqgitdlittpglinvdfadvkgimsgagtalmgigsargegrslka
    aeiainsplleasmegaqgvlmsiaggsdlglfeineaaslvqdaahpdaniifgtvidd
    slgdevrvtviaagfdvsgpgrkpvmgetggahriesakagkltstlfepvdavsvplht
    ngatlsiggddddvdvppfmrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rluA (A:)
    lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg
    agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg
    vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl
    lngvqgitdlittpglinvdfadvkgimsgagtalmgigsargegrslkaaeiainspll
    easmegaqgvlmsiaggsdlglfeineaaslvqdaahpdaniifgtviddslgdevrvtv
    iaagf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rluB (B:)
    gshmtpphnylavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkld
    vgrdstrglgagadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasi
    arklgaltvgvvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslm
    dafrsadevllngvqgitdlittpglinvdfadvkgimsgagtalmgigsargegrslka
    aeiainsplleasmegaqgvlmsiaggsdlglfeineaaslvqdaahpdaniifgtvidd
    slgdevrvtviaagfdvsgpgrkpvmgetggahriesakagkltstlfepvdavsvplht
    ngatlsiggddddvdvppfmrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rluB (B:)
    nylavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgadpevg
    rkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrpfsf
    egkrrsnqaengiaalrescdtlivipndrllqmvslmdafrsadevllngvqgitdlit
    tpglinvdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlm
    siaggsdlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf