PDB entry 1rls

View 1rls on RCSB PDB site
Description: crystal structure of RNAse t1 complexed with the product nucleotide 3'-gmp. structural evidence for direct interaction of histidine 40 and glutamic acid 58 with the 2'-hydroxyl group of ribose
Class: hydrolase(endoribonuclease)
Keywords: hydrolase(endoribonuclease)
Deposited on 1994-03-29, released 1994-12-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.167
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease t1
  Species: Aspergillus oryzae [TaxId:5062]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
  Domains in SCOPe 2.06: d1rlsa_
• Heterogens: CA, 3GP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rlsA (A:)
  acdytcgsncysssdvstaqaagyqlhedgetvgsnsyphkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect