PDB entry 1rlo

View 1rlo on RCSB PDB site
Description: Phospho-aspartyl Intermediate Analogue of ybiV from E. coli K12
Class: hydrolase
Keywords: beryllium trifluoride, HAD family, phospho-aspartate, HYDROLASE
Deposited on 2003-11-26, released 2004-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: YBIV, B0822
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75792
      • modified residue (8)
      • engineered (266)
    Domains in SCOPe 2.06: d1rloa_
  • Chain 'B':
    Compound: phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: YBIV, B0822
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75792
      • modified residue (8)
      • engineered (266)
    Domains in SCOPe 2.06: d1rlob_
  • Chain 'C':
    Compound: phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: YBIV, B0822
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75792
      • modified residue (8)
      • engineered (266)
    Domains in SCOPe 2.06: d1rloc_
  • Chain 'D':
    Compound: phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: YBIV, B0822
    Database cross-references and differences (RAF-indexed):
    • Uniprot P75792
      • modified residue (8)
      • engineered (266)
    Domains in SCOPe 2.06: d1rlod_
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rloA (A:)
    mavkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkd
    eisfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenape
    afvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgf
    gfidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenik
    qiaryatddnnhegalnviqavldntypfns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rloA (A:)
    vkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkdei
    sfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenapeaf
    valmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgfgf
    idliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenikqi
    aryatddnnhegalnviqavldntypfn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rloB (B:)
    mavkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkd
    eisfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenape
    afvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgf
    gfidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenik
    qiaryatddnnhegalnviqavldntypfns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rloB (B:)
    vkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkdei
    sfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenapeaf
    valmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgfgf
    idliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenikqi
    aryatddnnhegalnviqavldntypfn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rloC (C:)
    mavkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkd
    eisfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenape
    afvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgf
    gfidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenik
    qiaryatddnnhegalnviqavldntypfns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rloC (C:)
    vkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkdei
    sfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenapeaf
    valmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgfgf
    idliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenikqi
    aryatddnnhegalnviqavldntypfn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rloD (D:)
    mavkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkd
    eisfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenape
    afvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgf
    gfidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenik
    qiaryatddnnhegalnviqavldntypfns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rloD (D:)
    vkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkdei
    sfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenapeaf
    valmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgfgf
    idliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenikqi
    aryatddnnhegalnviqavldntypfn