PDB entry 1rlm

View 1rlm on RCSB PDB site
Description: crystal structure of ybiv from escherichia coli k12
Deposited on 2003-11-26, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rlma_
  • Chain 'B':
    Domains in SCOP 1.71: d1rlmb_
  • Chain 'C':
    Domains in SCOP 1.71: d1rlmc_
  • Chain 'D':
    Domains in SCOP 1.71: d1rlmd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rlmA (A:)
    mavkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkd
    eisfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenape
    afvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgf
    gfidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenik
    qiaryatddnnhegalnviqavldntypfns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rlmA (A:)
    avkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkde
    isfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenapea
    fvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgfg
    fidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenikq
    iaryatddnnhegalnviqavldntypfn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rlmB (B:)
    mavkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkd
    eisfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenape
    afvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgf
    gfidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenik
    qiaryatddnnhegalnviqavldntypfns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rlmB (B:)
    avkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkde
    isfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenapea
    fvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgfg
    fidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenikq
    iaryatddnnhegalnviqavldntypfn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rlmC (C:)
    mavkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkd
    eisfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenape
    afvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgf
    gfidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenik
    qiaryatddnnhegalnviqavldntypfns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rlmC (C:)
    avkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkde
    isfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenapea
    fvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgfg
    fidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenikq
    iaryatddnnhegalnviqavldntypfn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rlmD (D:)
    mavkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkd
    eisfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenape
    afvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgf
    gfidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenik
    qiaryatddnnhegalnviqavldntypfns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rlmD (D:)
    avkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkde
    isfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenapea
    fvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgfg
    fidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenikq
    iaryatddnnhegalnviqavldntypfn