PDB entry 1rlk

View 1rlk on RCSB PDB site
Description: Structure of Conserved Protein of Unknown Function TA0108 from Thermoplasma acidophilum
Deposited on 2003-11-25, released 2003-12-30
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.216
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1rlka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rlkA (A:)
    mvkkmviavrkdldmgkgkiaaqvahaavtcairsmkinrdvfnewydegqrkivvkvnd
    ldeimeikrmadsmgivneivqdrgytqvepgtitciglgpdeeekldkitgkykll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rlkA (A:)
    vkkmviavrkdldmgkgkiaaqvahaavtcairsmkinrdvfnewydegqrkivvkvndl
    deimeikrmadsmgivneivqdrgytqvepgtitciglgpdeeekldkitgkykll