PDB entry 1rlk

View 1rlk on RCSB PDB site
Description: Structure of Conserved Protein of Unknown Function TA0108 from Thermoplasma acidophilum
Class: Structural genomics, unknown function
Keywords: structural genomics, conserved hypothetical protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2003-11-25, released 2003-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.216
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein Ta0108
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: TA0108
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rlka_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1rlkA (A:)
mvkkmviavrkdldmgkgkiaaqvahaavtcairsmkinrdvfnewydegqrkivvkvnd
ldeimeikrmadsmgivneivqdrgytqvepgtitciglgpdeeekldkitgkykll

    Sequence, based on observed residues (ATOM records): (download) 
    >1rlkA (A:)
vkkmviavrkdldmgkgkiaaqvahaavtcairsmkinrdvfnewydegqrkivvkvndl
deimeikrmadsmgivneivqdrgytqvepgtitciglgpdeeekldkitgkykll