PDB entry 1rlh

View 1rlh on RCSB PDB site
Description: Structure of a conserved protein from Thermoplasma acidophilum
Class: structural genomics, unknown function
Keywords: Structural genomics, T. acidophilum, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2003-11-25, released 2004-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: CAC12474
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HII6 (20-End)
      • expression tag (4-19)
    Domains in SCOPe 2.06: d1rlha1, d1rlha2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1rlhA (A:)
mgsshhhhhhssglvprgshmvipaeaniivgyshfiktvedlneiirthvpgskygigf
seasgdrlirydgndddlvkacienirrisaghtfvilirnaypinilnavkmcqevgsi
faatanplqiivykgergngvlgvidgyspvgvesdadiekrrqflrrigyke

    Sequence, based on observed residues (ATOM records): (download) 
    >1rlhA (A:)
hhhhhhssglvprgshmvipaeaniivgyshfiktvedlneiirthvpgskygigfseas
gdrlirydgndddlvkacienirrisaghtfvilirnaypinilnavkmcqevgsifaat
anplqiivykgergngvlgvidgyspvgves