PDB entry 1rlh

View 1rlh on RCSB PDB site
Description: Structure of a conserved protein from Thermoplasma acidophilum
Deposited on 2003-11-25, released 2004-05-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1rlha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rlhA (A:)
    mgsshhhhhhssglvprgshmvipaeaniivgyshfiktvedlneiirthvpgskygigf
    seasgdrlirydgndddlvkacienirrisaghtfvilirnaypinilnavkmcqevgsi
    faatanplqiivykgergngvlgvidgyspvgvesdadiekrrqflrrigyke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rlhA (A:)
    hhhhhhssglvprgshmvipaeaniivgyshfiktvedlneiirthvpgskygigfseas
    gdrlirydgndddlvkacienirrisaghtfvilirnaypinilnavkmcqevgsifaat
    anplqiivykgergngvlgvidgyspvgves