PDB entry 1rlg

View 1rlg on RCSB PDB site
Description: Molecular basis of Box C/D RNA-protein interaction: co-crystal structure of the Archaeal sRNP intiation complex
Class: Structural Protein/RNA
Keywords: PROTEIN-RNA, Structural Protein/RNA COMPLEX
Deposited on 2003-11-25, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.235
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50S ribosomal protein L7Ae
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: RPL7AE, AF0764
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rlga_
  • Chain 'B':
    Compound: 50S ribosomal protein L7Ae
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: RPL7AE, AF0764
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rlgb_
  • Chain 'C':
    Compound: 25-mer
    Species:
    Gene:
  • Chain 'D':
    Compound: 25-mer
    Species:
    Gene:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rlgA (A:)
    myvrfevpedmqnealsllekvresgkvkkgtnettkaverglaklvyiaedvdppeiva
    hlpllceeknvpyiyvkskndlgravgievpcasaaiinegelrkelgslvekikglqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rlgA (A:)
    vpedmqnealsllekvresgkvkkgtnettkaverglaklvyiaedvdppeivahlpllc
    eeknvpyiyvkskndlgravgievpcasaaiinegelrkelgslvekikglqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rlgB (B:)
    myvrfevpedmqnealsllekvresgkvkkgtnettkaverglaklvyiaedvdppeiva
    hlpllceeknvpyiyvkskndlgravgievpcasaaiinegelrkelgslvekikglqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rlgB (B:)
    yvrfevpedmqnealsllekvresgkvkkgtnettkaverglaklvyiaedvdppeivah
    lpllceeknvpyiyvkskndlgravgievpcasaaiinegelrkelgslvekikglq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.