PDB entry 1rlf

View 1rlf on RCSB PDB site
Description: structure determination of the ras-binding domain of the ral-specific guanine nucleotide exchange factor rlf, nmr, 10 structures
Class: signal transduction protein
Keywords: signal transduction protein
Deposited on 1998-07-09, released 1999-02-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rlf
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q61193 (0-89)
  Domains in SCOPe 2.06: d1rlfa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rlfA (A:)
  gssdcriirvqmelgedgsvyksilvtsqdkapsvisrvlkknnrdsavasefelvqllp
  gdreltiphsanvfyamdgashdfllrqrr