PDB entry 1rld

View 1rld on RCSB PDB site
Description: solid-state phase transition in the crystal structure of ribulose 1,5-biphosphate carboxylase(slash)oxygenase
Class: lyase(carbon-carbon)
Keywords: lyase(carbon-carbon)
Deposited on 1993-12-10, released 1994-04-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.211
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00876 (0-445)
      • conflict (207)
      • conflict (355)
    Domains in SCOPe 2.06: d1rlda1, d1rlda2
  • Chain 'B':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00876 (0-445)
      • conflict (207)
      • conflict (355)
    Domains in SCOPe 2.06: d1rldb1, d1rldb2
  • Chain 'S':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rlds_
  • Chain 'T':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rldt_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rldA (A:)
    ltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgltsldryk
    grcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrip
    payvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftk
    ddenvnsqpfmrwrdrflfcaealykaeaetgeikghylnatagtceemikravfarelg
    vpivmhdyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrms
    ggdhihsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasgg
    ihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdlaqeg
    neiireackwspelaaacevwkeivf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rldA (A:)
    ltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstvwtdgltsldrykgrcyr
    iervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrippayvk
    tfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenv
    nsqpfmrwrdrflfcaealykaeaetgeikghylnatagtceemikravfarelgvpivm
    hdyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrmsggdhi
    hsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasggihvwh
    mpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdlaqegneiir
    eackwspelaaacevwkeivf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rldB (B:)
    ltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgltsldryk
    grcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrip
    payvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftk
    ddenvnsqpfmrwrdrflfcaealykaeaetgeikghylnatagtceemikravfarelg
    vpivmhdyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrms
    ggdhihsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasgg
    ihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdlaqeg
    neiireackwspelaaacevwkeivf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rldB (B:)
    ltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstvwtdgltsldrykgrcyr
    iervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrippayvk
    tfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenv
    nsqpfmrwrdrflfcaealykaeaetgeikghylnatagtceemikravfarelgvpivm
    hdyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrmsggdhi
    hsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasggihvwh
    mpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdlaqegneiir
    eackwspelaaacevwkeivf
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rldS (S:)
    mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
    yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
    egy
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rldT (T:)
    mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
    yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
    egy