PDB entry 1rlc

View 1rlc on RCSB PDB site
Description: crystal structure of the unactivated ribulose 1, 5-bisphosphate carboxylase(slash)oxygenase complexed with a transition state analog, 2-carboxy-d-arabinitol 1,5-bisphosphate
Deposited on 1993-08-04, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-03-08, with a file datestamp of 1995-03-23.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.196
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rlcL (L:)
    ltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdgltsldryk
    grcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrip
    payvktfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftk
    ddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtceemikravfarelg
    vpivmhdyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrms
    ggdhihsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasgg
    ihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdlaqeg
    neiireackwspelaaacevwkeivf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rlcL (L:)
    ltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstvwtdgltsldrykgrcyr
    iervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrledlrippayvk
    tfqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenv
    nsqpfmrwrdrflfcaealykaqaetgeikghylnatagtceemikravfarelgvpivm
    hdyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrmsggdhi
    hsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasggihvwh
    mpalteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdlaqegneiir
    eackwspelaaacevwkeivf
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rlcS (S:)
    mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
    yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
    egy