PDB entry 1rlb

View 1rlb on RCSB PDB site
Description: retinol binding protein complexed with transthyretin
Class: complex (protein/protein)
Keywords: complex (protein/protein)
Deposited on 1995-02-20, released 1996-04-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.215
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1rlba_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1rlbb_
  • Chain 'C':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1rlbc_
  • Chain 'D':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1rlbd_
  • Chain 'E':
    Compound: retinol binding protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02753 (0-173)
      • conflict (20)
      • conflict (49)
      • conflict (51)
      • conflict (106)
      • conflict (111)
      • conflict (113)
      • conflict (137)
      • conflict (141)
      • conflict (143-144)
      • conflict (146-147)
      • conflict (168)
    Domains in SCOPe 2.03: d1rlbe_
  • Chain 'F':
    Compound: retinol binding protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02753 (0-173)
      • conflict (20)
      • conflict (49)
      • conflict (51)
      • conflict (106)
      • conflict (111)
      • conflict (113)
      • conflict (137)
      • conflict (141)
      • conflict (143-144)
      • conflict (146-147)
      • conflict (168)
    Domains in SCOPe 2.03: d1rlbf_
  • Heterogens: REA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rlbA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rlbA (A:)
    tgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqf
    vegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    pke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rlbB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rlbB (B:)
    skcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfveg
    iykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rlbC (C:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rlbC (C:)
    tgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqf
    vegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    pke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rlbD (D:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rlbD (D:)
    skcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfveg
    iykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rlbE (E:)
    erdcrvssfrvkenfdkarfagtwyamakkdpeglflqdnivaefsvdenghmsatakgr
    vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdyetfavqysc
    rllnldgtcadsysfvfardpsgfspqvqkivrqrqeelclarqyrliphngyc
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rlbF (F:)
    erdcrvssfrvkenfdkarfagtwyamakkdpeglflqdnivaefsvdenghmsatakgr
    vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdyetfavqysc
    rllnldgtcadsysfvfardpsgfspqvqkivrqrqeelclarqyrliphngyc