PDB entry 1rl9

View 1rl9 on RCSB PDB site
Description: Crystal structure of Creatine-ADP arginine kinase ternary complex
Class: transferase
Keywords: arginine kinase, TRANSFERASE
Deposited on 2003-11-25, released 2004-05-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.194
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginine kinase
    Species: Limulus polyphemus [TaxId:6850]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51541 (Start-356)
      • conflict (115)
    Domains in SCOPe 2.01: d1rl9a1, d1rl9a2
  • Heterogens: MG, ADP, IOM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rl9A (A:)
    mvdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgven
    ldsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkewgdintlvdldpagqfi
    istrvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqq
    liddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlk
    tvykrlvtavdniesklpfshddrfgfltfcptnlgttmrasvhiqlpklakdrkvledi
    askfnlqvrgtrgehteseggvydisnkrrlglteyqavremqdgilemikmekaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rl9A (A:)
    vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
    dsgvgiyapdaesyrtfgplfdpiiddyhggfkltdkhppkewgdintlvdldpagqfii
    strvrcgrslqgypfnpcltaeqykemeekvsstlssmedelkgtyypltgmskatqqql
    iddhflfkegdrflqtanacrywptgrgifhndaktflvwvneedhlriismqkggdlkt
    vykrlvtavdniesklpfshddrfgfltfcptnlgttmrasvhiqlpklakdrkvledia
    skfnlqvrgtrgehteseggvydisnkrrlglteyqavremqdgilemikmekaaa