PDB entry 1rl6

View 1rl6 on RCSB PDB site
Description: ribosomal protein l6
Deposited on 1999-01-14, released 1999-02-02
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-27, with a file datestamp of 2000-03-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.257
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rl6A (A:)
    pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
    trsllanmvegvskgyekalelvgvgyraskqgkklvlsvgyshpveiepeegleievps
    qtkiivkgadkqrvgelaaniravrppepykgkgiryegelvrl