PDB entry 1rl3

View 1rl3 on RCSB PDB site
Description: Crystal structure of cAMP-free R1a subunit of PKA
Class: kinase
Keywords: Type 1a regulatory subunit, cAMP-dependent protein kinase, cAMP-free, KINASE
Deposited on 2003-11-24, released 2004-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.24
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase type I-alpha regulatory chain
    Species: Bos taurus [TaxId:9913]
    Gene: PRKAR1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rl3a1, d1rl3a2
  • Chain 'B':
    Compound: cAMP-dependent protein kinase type I-alpha regulatory chain
    Species: Bos taurus [TaxId:9913]
    Gene: PRKAR1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rl3b1, d1rl3b2
  • Heterogens: PCG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rl3A (A:)
    rrrrgaisaevyteedaasyvrkvipkdyktmaalakaieknvlfshlddnersdifdam
    fpvsfiagetviqqgdegdnfyvidqgemdvyvnnewatsvgeggsfgelaliygtpraa
    tvkaktnvklwgidrdsyrrilmgstlrkrkmyeeflskvsilesldkwerltvadalep
    vqfedgqkivvqgepgdeffiilegsaavlqrrseneefvevgrlgpsdyfgeiallmnr
    praatvvargplkcvkldrprfervlgpcsdilkrniqqynsfvslsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rl3A (A:)
    asyvrkvipkdyktmaalakaieknvlfshlddnersdifdamfpvsfiagetviqqgde
    gdnfyvidqgemdvyvnnewatsvgeggsfgelaliygtpraatvkaktnvklwgidrds
    yrrilmgstlrkrkmyeeflskvsilesldkwerltvadalepvqfedgqkivvqgepgd
    effiilegsaavlqrrseneefvevgrlgpsdyfgeiallmnrpraatvvargplkcvkl
    drprfervlgpcsdilkrniqqynsfvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rl3B (B:)
    rrrrgaisaevyteedaasyvrkvipkdyktmaalakaieknvlfshlddnersdifdam
    fpvsfiagetviqqgdegdnfyvidqgemdvyvnnewatsvgeggsfgelaliygtpraa
    tvkaktnvklwgidrdsyrrilmgstlrkrkmyeeflskvsilesldkwerltvadalep
    vqfedgqkivvqgepgdeffiilegsaavlqrrseneefvevgrlgpsdyfgeiallmnr
    praatvvargplkcvkldrprfervlgpcsdilkrniqqynsfvslsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rl3B (B:)
    asyvrkvipkdyktmaalakaieknvlfshlddnersdifdamfpvsfiagetviqqgde
    gdnfyvidqgemdvyvnnewatsvgeggsfgelaliygtpraatvkaktnvklwgidrds
    yrrilmgstlrkrkmyeeflskvsilesldkwerltvadalepvqfedgqkivvqgepgd
    effiilegsaavlqrrseneefvevgrlgpsdyfgeiallmnrpraatvvargplkcvkl
    drprfervlgpcsdilkrn