PDB entry 1rl2

View 1rl2 on RCSB PDB site
Description: ribosomal protein l2 RNA-binding domain from bacillus stearothermophilus
Class: ribosomal protein
Keywords: ribosomal protein, RNA-binding domain, peptidyltransferease center, x-ray diffraction
Deposited on 1999-03-25, released 1999-04-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribosomal protein l2)
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rl2a1, d1rl2a2
  • Chain 'B':
    Compound: protein (ribosomal protein l2)
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rl2b1, d1rl2b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rl2A (A:)
    qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
    dadikignalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasge
    vrmilgkcratvgevgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rl2A (A:)
    qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
    dadikignalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasge
    vrmilgkcratvgevg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rl2B (B:)
    qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
    dadikignalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasge
    vrmilgkcratvgevgn