PDB entry 1rl1

View 1rl1 on RCSB PDB site
Description: Solution structure of human Sgt1 CS domain
Class: protein degradation
Keywords: beta sandwich, 7 beta strands, similar to p23, lacking last beta strand seen in p23, PROTEIN DEGRADATION
Deposited on 2003-11-24, released 2004-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Suppressor of G2 allele of SKP1 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: SUGT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rl1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rl1A (A:)
    gshmthqskikydwyqtesqvvitlmiknvqkndvnvefsekelsalvklpsgedynlkl
    ellhpiipeqstfkvlstkieiklkkpeavrweklegqgdvptpkqfvadvknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rl1A (A:)
    skikydwyqtesqvvitlmiknvqkndvnvefsekelsalvklpsgedynlklellhpii
    peqstfkvlstkieiklkkpeavrweklegqg