PDB entry 1rl0

View 1rl0 on RCSB PDB site
Description: Crystal structure of a new ribosome-inactivating protein (RIP): dianthin 30
Class: hydrolase, plant protein
Keywords: mixed beta-sheet, alpha and beta regions, HYDROLASE, PLANT PROTEIN
Deposited on 2003-11-24, released 2004-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.184
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antiviral protein DAP-30
    Species: Dianthus caryophyllus [TaxId:3570]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rl0a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rl0A (A:)
    ataytlnlanpsasqyssfldqirnnvrdtsliyggtdvavigapsttdkflrlnfqgpr
    gtvslglrrenlyvvaylamdnanvnrayyfknqitsaeltalfpevvvanqkqleyged
    yqaieknakittgdqsrkelglginllitmidgvnkkvrvvkdearflliaiqmtaeaar
    fryiqnlvtknfpnkfdsenkviqfqvswskistaifgdckngvfnkdydfgfgkvrqak
    dlqmgllkylgrpks